Antibodies

View as table Download

Rabbit Polyclonal Anti-KLRC1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human KLRC1

Rabbit Polyclonal antibody to KLRC1 (killer cell lectin-like receptor subfamily C, member 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Chimpanzee, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of KLRC1 (Uniprot ID#P26715)

Rabbit polyclonal anti-KLRC1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KLRC1.

Rabbit Polyclonal Anti-KLRC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLRC1 antibody: synthetic peptide directed towards the C terminal of human KLRC1. Synthetic peptide located within the following region: SHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKH