Rabbit polyclonal antibody to PSPH (phosphoserine phosphatase)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Pig, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 175 of PSPH (Uniprot ID#P78330) |
Rabbit polyclonal Anti-PSPH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVA |
Rabbit polyclonal Anti-PSPH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSPH antibody: synthetic peptide directed towards the middle region of human PSPH. Synthetic peptide located within the following region: IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE |
Germany
Japan
United Kingdom
China
