Rabbit Polyclonal Anti-PARP2 Antibody
| Applications | IF, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARP2 antibody: synthetic peptide directed towards the middle region of human PARP2. Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA |
Rabbit polyclonal anti-PARP2 antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PARP2. |
Rabbit Polyclonal Anti-PARP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARP2 antibody is: synthetic peptide directed towards the C-terminal region of Human PARP2. Synthetic peptide located within the following region: QCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASD |
Germany
Japan
United Kingdom
China
