Rabbit Polyclonal Anti-TAF5L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF5L antibody: synthetic peptide directed towards the N terminal of human TAF5L. Synthetic peptide located within the following region: LTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQN |
Rabbit polyclonal anti-TAF5L antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF5L. |
Rabbit Polyclonal anti-TAF5L antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF5L antibody: synthetic peptide directed towards the N terminal of human TAF5L. Synthetic peptide located within the following region: FVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDI |
Rabbit Polyclonal Anti-TAF5L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF5L antibody: synthetic peptide directed towards the middle region of human TAF5L. Synthetic peptide located within the following region: CVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNG |
Rabbit Polyclonal Anti-TAF5L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF5L antibody: synthetic peptide directed towards the N terminal of human TAF5L. Synthetic peptide located within the following region: MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQS |
Rabbit Polyclonal Anti-TAF5L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF5L Antibody: A synthesized peptide derived from human TAF5L |
Germany
Japan
United Kingdom
China
