Antibodies

View as table Download

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Rat, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL

Rabbit polyclonal anti-GRP78 / HSPA5 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GRP78.

Anti-CALR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 20-218 amino acids of human calreticulin

Rabbit Polyclonal Anti-ARC Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARC
TA349251 is a possible alternative to TA349500.

Rabbit Polyclonal Anti-CANX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CANX

Anti-CALR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 20-218 amino acids of human calreticulin

Rabbit polyclonal HSP90B (Ab-254) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E).

Rabbit Polyclonal Anti-HSPA8 Antibody

Applications IHC, WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE

Rabbit polyclonal HSP90B (Ser254) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E).
Modifications Phospho-specific

Anti-CREB1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 12-341 amino acids of human cAMP responsive element binding protein 1

Rabbit polyclonal anti-CALR antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CALR.

Rabbit Polyclonal CIITA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CIITA antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human CIITA.

Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133.
Modifications Phospho-specific

Rabbit polyclonal CREB1 Antibody (Center)

Applications FC, IF, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen This CREB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 105-132 amino acids from the Central region of human CREB1.

Rabbit polyclonal HSP90AB1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Monkey)
Conjugation Unconjugated
Immunogen This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 697-724 amino acids from the C-terminal region of human HSP90AB1.