Antibodies

Jump to Filters
View as table Download
KAT5 Rabbit Polyclonal Antibody
TA349528

USD 380.00

In Stock

Rabbit Polyclonal Anti-KAT5 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KAT5
KAT5 Rabbit Polyclonal Antibody
TA319823

USD 570.00

In Stock

Rabbit Polyclonal KAT5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KAT5 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human KAT5.
KAT5 Rabbit Polyclonal Antibody
TA333921

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-HTATIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HTATIP Antibody: synthetic peptide directed towards the middle region of human HTATIP. Synthetic peptide located within the following region: VEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEI
KAT5 Rabbit Polyclonal Antibody
TA337014

USD 485.00

5 Days

Rabbit Polyclonal TIP60 Antibody

Applications IHC, Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acids 480-530 of human TIP60 was used as the immunogen.
KAT5 Rabbit Polyclonal Antibody
TA343605

USD 539.00

5 Days

Rabbit Polyclonal Anti-HTATIP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTATIP antibody: synthetic peptide directed towards the N terminal of human HTATIP. Synthetic peptide located within the following region: EGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWV
KAT5 Rabbit Polyclonal Antibody
TA315066

USD 380.00

In Stock

Rabbit polyclonal anti-TIP60 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TIP60.
KAT5 Rabbit Polyclonal Antibody
AP20318PU-N

USD 465.00

3 Weeks

KAT5 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
KAT5 Rabbit Polyclonal Antibody
TA315070

USD 380.00

4 Weeks

Rabbit polyclonal TIP60 (Ser86) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human TIP60 around the phosphorylation site of serine 86 (P-G-SP-R-P).
Modifications Phospho-specific
KAT5 Rabbit Polyclonal Antibody
TA330569

USD 539.00

5 Days

Rabbit Polyclonal Anti-HTATIP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTATIP antibody: synthetic peptide directed towards the N terminal of human HTATIP. Synthetic peptide located within the following region: EAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKERE
KAT5 Rabbit Polyclonal Antibody
TA315069

USD 380.00

In Stock

Rabbit polyclonal Tip60 (Ser90) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Tip60 around the phosphorylation site of serine 90 (P-G-SP-P-E).
Modifications Phospho-specific