Antibodies

Jump to Filters
View as table Download
NFkB Inducing Kinase NIK (MAP3K14) Rabbit Polyclonal Antibody
TA321611

USD 380.00

4 Weeks

Anti-MAP3K14 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human mitogen-activated protein kinase kinase kinase 14
NFkB Inducing Kinase NIK (MAP3K14) Rabbit Polyclonal Antibody
TA336951

USD 550.00

5 Days

Rabbit Polyclonal NIK/MAP3K14 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human MAP3K14 protein (between residues 800-900) [UniProt Q99558]
NFkB Inducing Kinase NIK (MAP3K14) Rabbit Polyclonal Antibody
TA321610

USD 380.00

In Stock

Anti-MAP3K14 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human mitogen-activated protein kinase kinase kinase 14
NFkB Inducing Kinase NIK (MAP3K14) Rabbit Polyclonal Antibody
AP14868PU-N

USD 580.00

2 Weeks

NFkB Inducing Kinase NIK (MAP3K14) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the center region of human NIK.
NFkB Inducing Kinase NIK (MAP3K14) Rabbit Polyclonal Antibody
TA305950

USD 570.00

5 Days

Rabbit Polyclonal NIK Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen NIK antibody was raised against a 17 amino acid peptide near the carboxy terminus of human NIK. The immunogen is located within the last 50 amino acids of NIK.
NFkB Inducing Kinase NIK (MAP3K14) Rabbit Polyclonal Antibody
TA346370

USD 539.00

5 Days

Rabbit Polyclonal Anti-MAP3K14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K14 antibody: synthetic peptide directed towards the N terminal of human MAP3K14. Synthetic peptide located within the following region: SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN