Antibodies

Jump to Filters
View as table Download
MAP4K4 Rabbit Polyclonal Antibody
TA314915

USD 380.00

4 Weeks

Rabbit polyclonal anti-MEKKK 4 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MEKKK 4.
MAP4K4 Rabbit Polyclonal Antibody
TA330965

USD 539.00

5 Days

Rabbit polyclonal Anti-MAP4K4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP4K4 antibody: synthetic peptide directed towards the N terminal of human MAP4K4. Synthetic peptide located within the following region: PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ
MAP4K4 Rabbit Polyclonal Antibody
AP20403PU-N

USD 465.00

3 Weeks

MAP4K4 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
MAP4K4 Rabbit Polyclonal Antibody
TA347637

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-MEKKK 4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MEKKK 4 Antibody: A synthesized peptide derived from human MEKKK 4