PIM2 Antibody (C-term ) Rabbit Polyclonal Antibody (Pab)
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PIM2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-308 amino acids from the C-terminal region of human PIM2. |
Rabbit Polyclonal Anti-PIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIM2 antibody: synthetic peptide directed towards the middle region of human PIM2. Synthetic peptide located within the following region: LRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVW |
Germany
Japan
United Kingdom
China
