Antibodies

Jump to Filters
View as table Download
ST14 (N-term) Rabbit Polyclonal Antibody
AP23643PU-N

USD 535.00

2 Weeks

ST14 (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ST14 antibody was raised against synthetic peptide - KLH conjugated
ST14 Rabbit Polyclonal Antibody
TA349391

USD 380.00

In Stock

Rabbit Polyclonal Anti-ST14 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ST14
ST14 Rabbit Polyclonal Antibody
TA346507

USD 539.00

5 Days

Rabbit Polyclonal Anti-ST14 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST14 antibody: synthetic peptide directed towards the C terminal of human ST14. Synthetic peptide located within the following region: SHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQIT
ST14 Rabbit Polyclonal Antibody
TA346508

USD 539.00

5 Days

Rabbit Polyclonal Anti-ST14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST14 antibody: synthetic peptide directed towards the middle region of human ST14. Synthetic peptide located within the following region: RHPGFEATFFQLPRMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEV