Antibodies

Jump to Filters
View as table Download
PPP1A (PPP1CA) Rabbit Polyclonal Antibody
AP20315PU-N

USD 465.00

3 Weeks

PPP1A (PPP1CA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPP1A (PPP1CA) Rabbit Polyclonal Antibody
TA343228

USD 539.00

5 Days

Rabbit Polyclonal Anti-PPP1CA Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp1ca antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ppp1ca. Synthetic peptide located within the following region: RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFS