Antibodies

Jump to Filters
View as table Download
MTMR7 Rabbit Polyclonal Antibody
TA349576

USD 380.00

In Stock

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MTMR7
Phosphoserine phosphatase (PSPH) Rabbit Polyclonal Antibody
TA308185

USD 625.00

2 Weeks

Rabbit polyclonal antibody to PSPH (phosphoserine phosphatase)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Pig, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 175 of PSPH (Uniprot ID#P78330)
MTMR7 Rabbit Polyclonal Antibody
TA332091

USD 539.00

5 Days

Rabbit Polyclonal Anti-MTMR7 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MTMR7 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR7. Synthetic peptide located within the following region: NLKSSDPDLSANSDQESGVEDLSCRSPSGGEHAPSEDSGKDRDSDEAVFL