Rabbit polyclonal anti-GPR12 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR12. |
Rabbit polyclonal anti-GPR12 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR12. |
GPR12 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GPR12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR12 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR12. Synthetic peptide located within the following region: SICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLY |