Antibodies

Jump to Filters
View as table Download
RAD1 (Center) Rabbit Polyclonal Antibody
AP53557PU-N

USD 580.00

2 Weeks

RAD1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 118-146 amino acids from the Central region of Human RAD1.
RAD1 Rabbit Polyclonal Antibody
TA344638

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAD1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD1 antibody: synthetic peptide directed towards the middle region of human RAD1. Synthetic peptide located within the following region: ITMSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLL
RAD1 Rabbit Polyclonal Antibody
TA361229

USD 539.00

5 Days

RAD1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human RAD1
RAD1 Rabbit Polyclonal Antibody
TA362604

USD 539.00

5 Days

RAD1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RAD1
RAD1 Rabbit Polyclonal Antibody
TA308831

USD 305.00

In Stock

Rabbit polyclonal antibody to RAD1 (RAD1 homolog (S. pombe))

Reactivities Human, Mouse (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 77 and 282 of RAD1 (Uniprot ID#O60671)