Antibodies

Jump to Filters
View as table Download
IL22RA1 Rabbit Polyclonal Antibody
TA322225

USD 380.00

In Stock

Anti-IL22RA1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 16-228 amino acids of human interleukin 22 receptor, alpha 1
IL22RA1 Rabbit Polyclonal Antibody
TA322224

USD 380.00

In Stock

Anti-IL22RA1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 16-228 amino acids of human interleukin 22 receptor, alpha 1
IL22RA1 Rabbit Polyclonal Antibody
TA306086

USD 570.00

2 Weeks

Rabbit Polyclonal IL-22 Receptor Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen IL-22 receptor antibody was raised against a synthetic peptide corresponding to amino acids near the amino terminus of human IL-22 receptor precursor .
IL22RA1 Rabbit Polyclonal Antibody
TA338469

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL22RA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL22RA1 antibody: synthetic peptide directed towards the middle region of human IL22RA1. Synthetic peptide located within the following region: YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ
IL22RA1 Rabbit Polyclonal Antibody
TA338470

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL22RA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL22RA1 antibody: synthetic peptide directed towards the middle region of human IL22RA1. Synthetic peptide located within the following region: DQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE