Antibodies

Jump to Filters
View as table Download
Phospholipase C beta 1 (PLCB1) Rabbit Polyclonal Antibody
TA327224

USD 365.00

3 Weeks

PLCB1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PLCB1
Phospholipase C beta 1 (PLCB1) Rabbit Polyclonal Antibody
TA333384

USD 539.00

5 Days

Rabbit Polyclonal Anti-PLCB1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLCB1 Antibody: synthetic peptide directed towards the middle region of human PLCB1. Synthetic peptide located within the following region: EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT