Antibodies

View as table Download

Anti-AIFM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human apoptosis-inducing factor, mitochondrion-associated, 1

Anti-AIFM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human apoptosis-inducing factor, mitochondrion-associated, 1

Rabbit anti-AIFM1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AIFM1

Rabbit Polyclonal AIF Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen AIF antibody was raised against a peptide corresponding to amino acids near the amino terminus of mature human AIF. The immunogen is located within amino acids 90 - 140 of AIF.

Rabbit Polyclonal AIF Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AIF antibody was raised against a peptide corresponding to amino acids 517 to 531 of human AIF. This sequence is identical to those of mouse and rat AIF.

Rabbit Polyclonal Anti-AIFM1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the N terminal of human PDCD8. Synthetic peptide located within the following region: GAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPS

Rabbit Polyclonal Anti-AIFM1 Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AIFM1 antibody: synthetic peptide directed towards the middle region of human AIFM1. Synthetic peptide located within the following region: VIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

Rabbit polyclonal anti-AIFM1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AIFM1.

Rabbit Polyclonal Anti-PDCD8 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the C terminal of human PDCD8. Synthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST