Antibodies

Jump to Filters
View as table Download
Importin 8 (IPO8) Rabbit Polyclonal Antibody
TA351296

USD 380.00

In Stock

Rabbit Polyclonal Anti-IPO8 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IPO8
Importin 8 (IPO8) Rabbit Polyclonal Antibody
TA337058

USD 550.00

5 Days

Rabbit Polyclonal Importin-8 Antibody

Applications ICC/IF, IP, Simple Western, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 850-900 of human Importin-8 was used as immunogen for the antibody.
Importin 8 (IPO8) Rabbit Polyclonal Antibody
TA338288

USD 539.00

5 Days

Rabbit Polyclonal Anti-IPO8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IPO8 antibody is: synthetic peptide directed towards the C-terminal region of Human IPO8. Synthetic peptide located within the following region: PPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENEE