Antibodies

Jump to Filters
View as table Download
EZH2 Rabbit Polyclonal Antibody
TA384195

USD 380.00

4 Weeks

KMT6 Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human KMT6 / EZH2
EZH2 Rabbit Polyclonal Antibody
TA319648

USD 570.00

5 Days

Rabbit Polyclonal EZH2 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen EZH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human EZH2.
EZH2 Rabbit Polyclonal Antibody
TA376050

USD 365.00

3 Weeks

EZH2/KMT6 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human EZH2/KMT6 (NP_001190176.1).
Modifications Unmodified
EZH2 Rabbit Polyclonal Antibody
TA376051

USD 365.00

3 Weeks

EZH2/KMT6 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human EZH2/KMT6 (NP_001190176.1).
Modifications Unmodified
EZH2 Rabbit Polyclonal Antibody
TA332879

USD 365.00

2 Weeks

Rabbit anti-EZH2 Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EZH2
EZH2 Rabbit Polyclonal Antibody
TA343463

USD 539.00

5 Days

Rabbit Polyclonal Anti-EZH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EZH2 antibody: synthetic peptide directed towards the N terminal of human EZH2. Synthetic peptide located within the following region: KGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQE
EZH2 Rabbit Polyclonal Antibody
TA376052

USD 365.00

3 Weeks

EZH2/KMT6 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human EZH2/KMT6.
EZH2 Rabbit Polyclonal Antibody
TA347126

USD 580.00

5 Days

Rabbit Polyclonal EzH2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-EzH2 antibody: the N-terminus (aa1-343) of the mouse EZH2 protein (Enhancer of zeste homolog 2).
EZH2 Rabbit Polyclonal Antibody
TA349564

USD 380.00

In Stock

Rabbit Polyclonal Anti-EZH2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human EZH2
EZH2 Rabbit Polyclonal Antibody
TA590182

USD 482.00

In Stock

Rabbit Polyclonal KMT6/EZH2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
EZH2 Rabbit Polyclonal Antibody
TA347894

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-EZH2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EZH2 Antibody: A synthesized peptide derived from human EZH2
Ezh2 Rabbit Polyclonal Antibody
TA362887

USD 539.00

5 Days

EZH2 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse EZH2
EZH2 Rabbit Polyclonal Antibody
TA368948

USD 380.00

4 Weeks

EZH2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human EZH2