Rabbit Polyclonal antibody to PDE1A (phosphodiesterase 1A, calmodulin-dependent)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Dog, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 212 and 535 of PDE1A (Uniprot ID#P54750) |
Rabbit Polyclonal Anti-PDE1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDE1A Antibody: synthetic peptide directed towards the C terminal of human PDE1A. Synthetic peptide located within the following region: AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET |
PDE1A Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PDE1A |
Germany
Japan
United Kingdom
China
