Antibodies

Jump to Filters
View as table Download
CD79A Rabbit Polyclonal Antibody
TA311916

USD 380.00

In Stock

Rabbit polyclonal anti-CD79A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CD79A.
CD79A Rabbit Polyclonal Antibody
TA351934

USD 380.00

In Stock

Rabbit Polyclonal Anti-HAO1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD79A
CD79A Rabbit Polyclonal Antibody
TA343279

USD 539.00

5 Days

Rabbit Polyclonal Anti-CD79A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD79A antibody is: synthetic peptide directed towards the C-terminal region of Human CD79A. Synthetic peptide located within the following region: AVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRG
CD79A Rabbit Polyclonal Antibody
TA354220

USD 405.00

5 Days

Rabbit anti CD79a Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated