Antibodies

Jump to Filters
View as table Download
GNB1 Rabbit Polyclonal Antibody
TA349322

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-GNB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GNB1
GNB1 Rabbit Polyclonal Antibody
TA335041

USD 539.00

5 Days

Rabbit Polyclonal Anti-GNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNB1 antibody: synthetic peptide directed towards the N terminal of human GNB1. Synthetic peptide located within the following region: MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRT
GNB1 Rabbit Polyclonal Antibody
TA335042

USD 539.00

5 Days

Rabbit Polyclonal Anti-GNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNB1 antibody: synthetic peptide directed towards the C terminal of human GNB1. Synthetic peptide located within the following region: DLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKAD