Antibodies

Jump to Filters
View as table Download
AMPD2 Rabbit Polyclonal Antibody
TA313450

USD 380.00

4 Weeks

Rabbit polyclonal anti-AMPD2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AMPD2.
AMPD2 Rabbit Polyclonal Antibody
TA338196

USD 539.00

5 Days

Rabbit Polyclonal Anti-AMPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AMPD2 antibody is: synthetic peptide directed towards the N-terminal region of Human AMPD2. Synthetic peptide located within the following region: VVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSA