Antibodies

Jump to Filters
View as table Download
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA350295

USD 380.00

In Stock

Rabbit Polyclonal Anti-PPP2CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP2CA
PP2A-alpha (PPP2CA) (N-term) Rabbit Polyclonal Antibody
AP23366PU-N

USD 560.00

2 Weeks

PP2A-alpha (PPP2CA) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence mapping near the N-terminal of human PP2A
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
AP05050PU-N

USD 580.00

5 Days

PP2A-alpha (PPP2CA) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The purified peptide conjugated to KLH.
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA335806

USD 539.00

5 Days

Rabbit Polyclonal Anti-PPP2CA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPP2CA Antibody is: synthetic peptide directed towards the N-terminal region of Human PPP2CA. Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI