Rabbit Polyclonal Anti-SOD2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD2 antibody: synthetic peptide directed towards the N terminal of human SOD2. Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH |
Rabbit anti-SOD2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SOD2 |
Anti-SOD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 25-222 amino acids of human superoxide dismutase 2, mitochondrial |
Rabbit Polyclonal Anti-sod2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-sod2 Antibody: A synthesized peptide derived from human sod2 |
Germany
Japan
United Kingdom
China
