Antibodies

View as table Download

Rabbit polyclonal FGR Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FGR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 3-33 amino acids from the N-terminal region of human FGR.

Rabbit polyclonal anti-FGR antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FGR.

Rabbit anti-FGR Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human FGR

Rabbit Polyclonal Anti-FGR Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FGR antibody: synthetic peptide directed towards the middle region of human FGR. Synthetic peptide located within the following region: CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ