Antibodies

View as table Download

Rabbit Polyclonal Anti-SEMA6A Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEMA6A

Rabbit Polyclonal Anti-SEMA6A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEMA6A

Rabbit Polyclonal Anti-SEMA6A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA6A antibody: synthetic peptide directed towards the middle region of human SEMA6A. Synthetic peptide located within the following region: ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR