Antibodies

Jump to Filters
View as table Download
mSin3A (SIN3A) Rabbit Polyclonal Antibody
TA327087

USD 365.00

3 Weeks

SIN3A Rabbit Polyclonal Antibody

Applications ChIP, ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIN3A
mSin3A (SIN3A) Rabbit Polyclonal Antibody
TA330564

USD 539.00

5 Days

Rabbit Polyclonal Anti-SIN3A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIN3A antibody: synthetic peptide directed towards the N terminal of human SIN3A. Synthetic peptide located within the following region: KRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSA