Antibodies

Jump to Filters
View as table Download
Macrophage Inflammatory Protein 4 (CCL18) Rabbit Polyclonal Antibody
TA330388

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-CCL18 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL18 antibody: synthetic peptide directed towards the middle region of human CCL18. Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA