Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
Applications | FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
Rabbit Polyclonal active/cleaved Caspase 3 Antibody
Applications | FC, ICC/IF, IHC, Immunoblotting, IP, WB |
Reactivities | Human, Mouse, Rat, Canine, Gerbil |
Conjugation | Unconjugated |
Immunogen | Recombinant catalytically active human caspase-3 protein was used as immunogen. |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal Cleaved-caspase 3 antibody
Applications | WB |
Reactivities | Mouse, Rat, Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Rabbit polyclonal Caspase 3 (cleaved-Asp175) antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Caspase 3. |
Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast |
Conjugation | Unconjugated |
Immunogen | Recombinant human Caspase-3 protein (full length) |
Rabbit Polyclonal Anti-UQCRC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV |
Rabbit Polyclonal Anti-PGP9.5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PGP9.5 Antibody: A synthesized peptide derived from human PGP9.5 |