Rabbit Polyclonal antibody to IPMK (inositol polyphosphate multikinase)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 26 and 295 of IPMK (Uniprot ID#Q8NFU5) |
Rabbit Polyclonal Anti-PIP5K1A Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pip5k1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a. Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS |
Germany
Japan
United Kingdom
China
