Antibodies

Jump to Filters
View as table Download
Neuraminidase (NEU1) Rabbit Polyclonal Antibody
TA335236

USD 485.00

2 Weeks

Rabbit Polyclonal Anti-NEU1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG
GBA Rabbit Polyclonal Antibody
TA325083

USD 580.00

2 Weeks

Rabbit polyclonal GC Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse (Predicted: Bovine, Pig)
Conjugation Unconjugated
Immunogen This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC.