Antibodies

Jump to Filters
View as table Download
C5ORF33 (NADK2) Rabbit Polyclonal Antibody
TA338318

USD 539.00

5 Days

Rabbit Polyclonal Anti-NADK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NADK2antibody: synthetic peptide directed towards the middle region of human C5orf33. Synthetic peptide located within the following region: RWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEA
C5ORF33 (NADK2) Rabbit Polyclonal Antibody
TA360822

USD 539.00

5 Days

NADK2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human C5ORF33