Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Tmp21/p23 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Primate, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal sequence of the human TMP21 protein (within residues 100-200). [Swiss-Prot# P49755] |
Rabbit Polyclonal Tmp21/p23 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate, Rabbit, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal sequence of the human TMP21 protein (within residues 50-150). [Swiss-Prot# P49755] |
Rabbit Polyclonal Anti-TMED10 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMED10 antibody: synthetic peptide directed towards the middle region of human TMED10. Synthetic peptide located within the following region: KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF |
TMED10 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human TMED10 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- TMP21
Antibody Hosts
- Rabbit