Antibodies

Jump to Filters
View as table Download
GNAQ Rabbit Polyclonal Antibody
TA376641

USD 365.00

3 Weeks

GNAQ Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-359 of human GNAQ (NP_002063.2).
Modifications Unmodified
GNAQ Rabbit Monoclonal Antibody [Clone ID: R08-2D5]
TA384308

USD 380.00

4 Weeks

GNAQ Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
GNAQ Rabbit Polyclonal Antibody
TA335040

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-GNAQ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAQ antibody: synthetic peptide directed towards the N terminal of human GNAQ. Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
GNAQ Rabbit Polyclonal Antibody
TA360108

USD 539.00

5 Days

GNAQ Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNAQ