Antibodies

Jump to Filters
View as table Download
C1QA Rabbit Polyclonal Antibody
TA890256

USD 407.00

In Stock

C1QA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Human recombinant protein fragment of human C1QA ( NP_057075) produced in E.coli.
C1QA Rabbit Polyclonal Antibody
TA342833

USD 539.00

In Stock

Rabbit Polyclonal Anti-C1QA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1QA antibody: synthetic peptide directed towards the N terminal of human C1QA. Synthetic peptide located within the following region: PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG