Anti-PTGES2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 90-377 amino acids of human prostaglandin E synthase 2 |
Anti-PTGES2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 90-377 amino acids of human prostaglandin E synthase 2 |
Anti-PTGES2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 90-377 amino acids of human prostaglandin E synthase 2 |
Rabbit polyclonal antibody to PTGES2 (prostaglandin E synthase 2)
Applications | WB |
Reactivities | Human (Predicted: Chimpanzee) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 106 and 343 of PTGES2 (Uniprot ID#Q9H7Z7) |
Rabbit Polyclonal Anti-PTGES2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the N-terminal region of Human PTGES2. Synthetic peptide located within the following region: KEVTEFGNKYWLMLNEKEAQQVYGGKEARTEEMKWRQWADDWLVHLISPN |
Rabbit Polyclonal Anti-PTGES2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTGES2 antibody is: synthetic peptide directed towards the middle region of Human PTGES2. Synthetic peptide located within the following region: VAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKDRPFMG |