Antibodies

Jump to Filters
View as table Download
ALDH9A1 Rabbit Polyclonal Antibody
TA323584

USD 380.00

In Stock

Anti-ALDH9A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1
ALDH9A1 Rabbit Polyclonal Antibody
TA323585

USD 380.00

In Stock

Anti-ALDH9A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 18-32 amino acids of human aldehyde dehydrogenase 9 family, member A1
ALDH9A1 Rabbit Polyclonal Antibody
TA342665

USD 539.00

5 Days

Rabbit Polyclonal Anti-ALDH9A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH9A1 antibody: synthetic peptide directed towards the C terminal of human ALDH9A1. Synthetic peptide located within the following region: MGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPC
ALDH9A1 Rabbit Polyclonal Antibody
TA890045

USD 407.00

In Stock

Rabbit polyclonal anti-ALDH9A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH9A1
ALDH9A1 Rabbit Polyclonal Antibody
TA890045S

USD 188.00

2 Days

Rabbit polyclonal anti-ALDH9A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH9A1

Special Offer: Get this product for $99/€99. Use code: "Truesample".