Antibodies

Jump to Filters
View as table Download
GSTO2 Rabbit Polyclonal Antibody
TA331016

USD 539.00

5 Days

Rabbit polyclonal Anti-GSTO2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTO2 antibody: synthetic peptide directed towards the N terminal of human GSTO2. Synthetic peptide located within the following region: VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV
GSTO2 Rabbit Polyclonal Antibody
TA332906

USD 365.00

3 Weeks

Rabbit anti-GSTO2 Polyclonal Antibody

Applications WB
Reactivities Mouse, Rat, Human
Conjugation Unconjugated
Immunogen Recombinant protein of human GSTO2