Antibodies

Jump to Filters
View as table Download
KIR2DL4 (C-term) Rabbit Polyclonal Antibody
AP52370PU-N

USD 580.00

2 Weeks

KIR2DL4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 302~332 amino acids from the C-terminal region of human CD158d / KIR2DL4
KIR2DL4 Rabbit Polyclonal Antibody
TA346319

USD 539.00

5 Days

Rabbit Polyclonal Anti-KIR2DL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIR2DL4 antibody: synthetic peptide directed towards the middle region of human KIR2DL4. Synthetic peptide located within the following region: VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR