Antibodies

View as table Download

Rabbit Polyclonal Anti-FARSB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FARSB

Rabbit Polyclonal Anti-FARSB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FARSB Antibody is: synthetic peptide directed towards the N-terminal region of Human FARSB. Synthetic peptide located within the following region: EEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDVVLYKIDVPANR

Rabbit Polyclonal Anti-FARSB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FARSB Antibody is: synthetic peptide directed towards the N-terminal region of Human FARSB. Synthetic peptide located within the following region: HDLDTLSGPFTYTAKRPSDIKFKPLNKTKEYTACELMNIYKTDNHLKHYL