Antibodies

Jump to Filters
View as table Download
XRN1 Rabbit Polyclonal Antibody
TA343888

USD 539.00

5 Days

Rabbit Polyclonal Anti-XRN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XRN1 antibody: synthetic peptide directed towards the middle region of human XRN1. Synthetic peptide located within the following region: LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM
XRN1 Rabbit Polyclonal Antibody
TA372028

USD 380.00

4 Weeks

XRN1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human XRN1