Antibodies

Jump to Filters
View as table Download
CAMK2A Rabbit Polyclonal Antibody
TA383858

USD 380.00

4 Weeks

CaMKII Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human CaMKII
CAMK2B Rabbit Polyclonal Antibody
TA323201

USD 380.00

In Stock

Anti-CAMK2B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 14-272 amino acids of human Calcium/calmodulin-dependent protein kinase type II subunit beta
CAMK2B Rabbit Polyclonal Antibody
TA323202

USD 380.00

In Stock

Anti-CAMK2B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 14-272 amino acids of Human Calcium/calmodulin-dependent protein kinase type II subunit beta
CAMK2B Rabbit Polyclonal Antibody
TA325290

USD 380.00

In Stock

Rabbit Polyclonal CaMK2- beta/ gamma/ delta (Thr287) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CaMK2- beta/ gamma/ delta around the phosphorylation site of Threonine 287
Modifications Phospho-specific
CAMK2A Rabbit Polyclonal Antibody
TA383859

USD 380.00

4 Weeks

CaMKII beta Rabbit polyclonal Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human CaMKII
CAMK2B Rabbit Polyclonal Antibody
TA325289

USD 380.00

In Stock

Rabbit Polyclonal CaMK2-beta/gamma/delta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CaMK2-beta/gamma/delta
CAMK2B Rabbit Polyclonal Antibody
TA313551

USD 380.00

In Stock

Rabbit polyclonal CaMK2-beta/gamma/delta (Thr287) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CaMK2-β/?/d around the phosphorylation site of threonine 287 (Q-E-TP-V-E).
Modifications Phospho-specific
Camk2b Rabbit Polyclonal Antibody
TA334128

USD 539.00

5 Days

Rabbit Polyclonal Anti-Camk2b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Camk2b Antibody is: synthetic peptide directed towards the middle region of Rat Camk2b. Synthetic peptide located within the following region: DIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKCKG
CAMK2B Rabbit Polyclonal Antibody
TA374231

USD 365.00

3 Weeks

CaMKII Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human CaMKII (NP_742078.1).
Modifications Unmodified
CAMK2B Rabbit Polyclonal Antibody
TA420001

USD 770.00

3 Weeks

CaMK2 delta/CAMK2 gamma Rabbit mAb

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMK2 delta/CAMK2 gamma (Q13554).