Antibodies

Jump to Filters
View as table Download
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA335249

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP
TRP1 (TYRP1) Rabbit Polyclonal Antibody
TA335247

USD 485.00

5 Days

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the N terminal of human TYRP1. Synthetic peptide located within the following region: AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF