Antibodies

Jump to Filters
View as table Download
EGLN1 Rabbit Polyclonal Antibody
TA350280

USD 380.00

In Stock

Rabbit Polyclonal Anti-EGLN1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human EGLN1
EGLN1 Rabbit Polyclonal Antibody
TA337248

USD 485.00

5 Days

Rabbit Polyclonal Anti-EGLN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGLN1 antibody: synthetic peptide directed towards the C terminal of human EGLN1. Synthetic peptide located within the following region: QPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF
EGLN1 Rabbit Polyclonal Antibody
TA326953

USD 365.00

3 Weeks

EGLN1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EGLN1