Antibodies

View as table Download

Rabbit Polyclonal Anti-TRDMT1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRDMT1

Rabbit Polyclonal DNMT2 Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT2 antibody: mouse Dnmt2 (DNA methyltransferase 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the N-terminal part of the protein (1).

Rabbit Polyclonal Anti-TRDMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRDMT1 antibody: synthetic peptide directed towards the N terminal of human TRDMT1. Synthetic peptide located within the following region: MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV