Antibodies

Jump to Filters
View as table Download
ABCD4 Rabbit Polyclonal Antibody
TA312919

USD 380.00

In Stock

Rabbit polyclonal anti-ABCD4 antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCD4.
ABCD4 Rabbit Polyclonal Antibody
TA322672

USD 380.00

In Stock

Anti-ABCD4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 137-149 amino acids of human ATP-binding cassette, sub-family D (ALD), member 4
ABCD4 Rabbit Polyclonal Antibody
TA322673

USD 380.00

In Stock

Anti-ABCD4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 137-149 amino acids of human ATP-binding cassette, sub-family D (ALD), member 4
ABCD4 Rabbit Polyclonal Antibody
TA310031

USD 285.00

3 Weeks

Rabbit anti-ABCD4 polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABCD4.
ABCD4 Rabbit Polyclonal Antibody
TA332077

USD 539.00

5 Days

Rabbit Polyclonal Anti-ABCD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the N terminal of human ABCD4. Synthetic peptide located within the following region: YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL
ABCD4 Rabbit Polyclonal Antibody
TA332078

USD 485.00

5 Days

Rabbit Polyclonal Anti-ABCD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the C terminal of human ABCD4. Synthetic peptide located within the following region: FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA