Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-TAF6L antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF6L. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TAF6L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF6L antibody: synthetic peptide directed towards the N terminal of human TAF6L. Synthetic peptide located within the following region: MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQN |
Rabbit Polyclonal Anti-TAF6L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF6L antibody: synthetic peptide directed towards the N terminal of human TAF6L. Synthetic peptide located within the following region: MSEREERRFVEIPRESVRLMAESTGLELSDEVAALLAEDVCYRLREATQN |
Rabbit Polyclonal Anti-TAF6L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAF6L antibody is: synthetic peptide directed towards the C-terminal region of Human TAF6L. Synthetic peptide located within the following region: GRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTSRPARRWALSDYSLY |
Rabbit Polyclonal Anti-TAF6L Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF6L Antibody: A synthesized peptide derived from human TAF6L |
Active filters
Category
- Antibodies
Target Symbol
- TAF6L
Antibody Hosts
- Rabbit
Families
- Transcription Factors
Pathways
- Basal transcription factors