Antibodies

Jump to Filters
View as table Download
RPC62 (POLR3C) Rabbit Polyclonal Antibody
TA326107

USD 380.00

In Stock

Rabbit polyclonal RPC3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC3.
RPC62 (POLR3C) Rabbit Polyclonal Antibody
TA340114

USD 539.00

5 Days

Rabbit Polyclonal Anti-POLR3C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3C antibody: synthetic peptide directed towards the middle region of human POLR3C. Synthetic peptide located within the following region: VEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQV