Antibodies

View as table Download

Rabbit polyclonal anti-FRK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FRK.

Rabbit Polyclonal Anti-FRK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FRK antibody: synthetic peptide directed towards the N terminal of human FRK. Synthetic peptide located within the following region: LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH

Rabbit Polyclonal Anti-FRK Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FRK

Rabbit Polyclonal Anti-FRK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FRK antibody: synthetic peptide directed towards the middle region of human FRK. Synthetic peptide located within the following region: DLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPG